LOCUS AM087455 1020 bp DNA linear BCT 24-SEP-2006
DEFINITION Chryseobacterium indologenes blaIND-6 gene for
metallo-beta-lactamase IND-6.
ACCESSION AM087455
VERSION AM087455.1 GI:115312787
KEYWORDS blaIND-6 gene; metallo-beta-lactamase IND-6.
SOURCE Chryseobacterium indologenes
ORGANISM Chryseobacterium indologenes
Bacteria; Bacteroidetes; Flavobacteria; Flavobacteriales;
Flavobacteriaceae; Chryseobacterium.
REFERENCE 1
AUTHORS Zeba,B., Simpore,J., Nacoulma,O.G., Rossolini,G.M., Frere,J.M. and
Docquier,J.D.
TITLE Characterization of a new IND-variant from Chryseobacterium
indologenes: First report of a metallo-beta-lactamase-producing
clinical isolate from Africa
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1020)
AUTHORS Docquier,J.D.
TITLE Direct Submission
JOURNAL Submitted (24-SEP-2005) Docquier J.D., Centre for Protein
Engineering, University of Liege, Allee de la Chimie, Sart-Tilman,
B-4000, BELGIUM
FEATURES Location/Qualifiers
source 1..1020
/organism="Chryseobacterium indologenes"
/mol_type="genomic DNA"
/isolate="597"
/db_xref="taxon:253"
/country="Burkina Faso"
gene 292..1011
/gene="blaIND-6"
CDS 292..1011
/gene="blaIND-6"
/EC_number="3.5.2.6"
/function="beta-lactam hydrolysis"
/codon_start=1
/transl_table=11
/product="metallo-beta-lactamase IND-6"
/protein_id="CAJ32373.1"
/db_xref="GI:115312788"
/translation="MKRRIQFFMVSMMLTPLFSAQVKDFVIEPPIKKNLYIYKTFGVF
GGKEYSANSVYLVTKTGVVLFDVPWEKAQYQSLMDTIKKRHNLPVVAVFATHSHDDRA
GDLSFFNNKGIKTYATPKTNQFLKKDGKATSTELIKPGKPYRFGGEEFVVDFLGEGHT
ADNVVVWFPKYKVLDGGCLVKSNSATDLGYIKEANLEQWPKTMHKLKTKYSEAVLIIP
GHDEWKGGGHVEHTLELLDKK"
ORIGIN
1 atcgatgact atagaaattg agggcaaaaa agaagttcta agcaaaaagg ctacagaaaa
61 aatattggta aagaaataat actacctttc tttctaaagc tgtttttgcg aagattacac
121 aaatatattt tcatttgcac attcctaata cctcctcaca actgttaaaa aacggttaaa
181 tttcttgcta taaaaagctt caagaattaa ttttactagg tttgcaacat cttctgctgg
241 agattccata tctccagcaa aatcctaacc tctaattatt acctttaaat tatgaaaaga
301 agaattcagt tctttatggt ttcaatgatg cttaccccat tattcagtgc ccaggtaaaa
361 gattttgtaa ttgaaccgcc aataaaaaag aacttatata tttataaaac tttcggagtg
421 ttcgggggaa aagaatattc tgccaattca gtgtatcttg tcaccaaaac cggggttgtt
481 ttatttgatg ttccctggga aaaagcgcaa taccaaagcc tgatggatac catcaaaaaa
541 cgtcataatt tacctgttgt tgcggtattt gcgacacatt cccatgatga ccgggcagga
601 gatttaagct ttttcaataa taaaggaatt aaaacctatg ctactcctaa aaccaatcaa
661 tttctgaaaa aagacggaaa ggctacttct acagagctca ttaagcccgg aaaaccttac
721 cgctttggcg gagaggaatt tgtagtggat tttcttggtg aagggcatac tgccgataat
781 gtagtggtat ggtttccaaa atataaagtg ctggatggcg gctgccttgt aaaaagcaat
841 tcagctaccg atttagggta tatcaaagaa gctaatctag agcaatggcc taaaaccatg
901 cataaactga aaacaaaata ttcagaagca gtattaatta ttcccggaca tgatgaatgg
961 aaaggcggcg ggcacgttga acatactttg gagctgctgg ataagaaata ataaatcgat
//
LOCUS AY015641 204 bp DNA linear VRL 06-SEP-2006
DEFINITION HIV-1 clone h21bf from Burkina Faso gag protein (gag) gene, partial
cds.
ACCESSION AY015641
VERSION AY015641.1 GI:12039044
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1
Viruses; Retro-transcribing viruses; Retroviridae;
Orthoretrovirinae; Lentivirus; Primate lentivirus group.
REFERENCE 1 (bases 1 to 204)
AUTHORS Ferraboli,S., Simpore,J., Pignatelli,S. and Barlati,S.
TITLE Identification of nucleotide variants of recombinant AG-Ibng like
strains in the central portion of the p24 region in the gag gene
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 204)
AUTHORS Ferraboli,S.
TITLE Direct Submission
JOURNAL Submitted (07-DEC-2000) Biomedical Sciences and Biotechnology,
Division of Biology and Genetics, University of Brescia, via
Valsabbina 19, Brescia 25123, Italy
FEATURES Location/Qualifiers
source 1..204
/organism="Human immunodeficiency virus 1"
/proviral
/mol_type="genomic DNA"
/db_xref="taxon:11676"
/clone="h21bf"
/country="Burkina Faso: Centre Medical Saint-Camille,
Ouagadougou"
/note="isolated from WBC genomic DNA from 31 year old
African female with CD4 count of 153"
gene <1..>204
/gene="gag"
/note="synonym: p24"
CDS <1..>204
/gene="gag"
/codon_start=1
/product="gag protein"
/protein_id="AAG39472.1"
/db_xref="GI:12039045"
/translation="DRTHPVHAGPIPPGQMREPRGSDIAGTTSTLQEQIGWMTGNPPI
PVGEIYKRWIVLGLNKIVRMYSPV"
variation 18
/gene="gag"
/note="silent mutation"
/replace="c"
variation 108
/gene="gag"
/note="results in substitution of serine with glycine"
/replace="a"
ORIGIN
1 gacaggacac atccagtaca tgcagggcct attccaccag gccagatgag ggaaccaagg
61 ggaagtgaca tagcaggaac tactagtacc cttcaagaac aaataggatg gatgacaggc
121 aatccaccta tcccagtggg agaaatttat aaaagatgga tagtcctggg attaaataaa
181 atagtaagaa tgtatagccc tgtc
//
LOCUS AY015640 242 bp DNA linear VRL 06-SEP-2006
DEFINITION HIV-1 clone h21bfm from Burkina Faso gag protein (gag) gene,
partial cds.
ACCESSION AY015640
VERSION AY015640.1 GI:12039042
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1
Viruses; Retro-transcribing viruses; Retroviridae;
Orthoretrovirinae; Lentivirus; Primate lentivirus group.
REFERENCE 1 (bases 1 to 242)
AUTHORS Ferraboli,S., Simpore,J., Pignatelli,S. and Barlati,S.
TITLE Identification of nucleotide variants of recombinant AG-Ibng like
strains in the central portion of the p24 region in the gag gene
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 242)
AUTHORS Ferraboli,S.
TITLE Direct Submission
JOURNAL Submitted (07-DEC-2000) Biomedical Sciences and Biotechnology,
Division of Biology and Genetics, University of Brescia, via
Valsabbina 19, Brescia 25123, Italy
FEATURES Location/Qualifiers
source 1..242
/organism="Human immunodeficiency virus 1"
/proviral
/mol_type="genomic DNA"
/db_xref="taxon:11676"
/clone="h21bfm"
/country="Burkina Faso: Centre Medical Saint-Camille,
Ouagadougou"
/note="isolated from WBC genomic DNA from 31 year old
African female with CD4 count of 153"
gene <1..>242
/gene="gag"
/note="synonym: p24"
CDS <1..>242
/gene="gag"
/codon_start=2
/product="gag protein"
/protein_id="AAG39471.1"
/db_xref="GI:12039043"
/translation="LKDTINEEAAEWDRTHPVHAGPIPPGQMREPRGSDIAGTTSTLQ
EQIGWMTSNPPIPVGEIYKRWIVLGLNKIVRMYSPV"
variation 55
/gene="gag"
/note="silent mutation"
/replace="c"
ORIGIN
1 gttaaaagat accatcaatg aggaagctgc agaatgggac aggacacatc cagtacatgc
61 agggcctatt ccaccaggcc agatgaggga accaagggga agtgacatag caggaactac
121 tagtaccctt caagaacaaa taggatggat gacaagcaat ccacctatcc cagtgggaga
181 aatttataaa agatggatag tcctgggatt aaataaaata gtaagaatgt atagccctgt
241 ca
//
LOCUS CS146134 20 bp DNA linear PAT 13-JUL-2006 DEFINITION Sequence 20 from Patent WO2005075679. ACCESSION CS146134 VERSION CS146134.1 GI:74036598 KEYWORDS . SOURCE synthetic construct ORGANISM synthetic construct other sequences; artificial sequences. REFERENCE 1 AUTHORS Amicosante,M., Cappelli,G., Colizzi,V., D'Arrigo,R., Dieli,F., Perno,C.F., Sacchi,A., Salerno,A., Montagner,L.U., Chenal,H., Toni,T. and Simpore,J. JOURNAL Patent: WO 2005075679-A 20 18-AUG-2005; ARRAY(0x141678e80) FEATURES Location/Qualifiers source 1..20 /organism="synthetic construct" /mol_type="unassigned DNA" /db_xref="taxon:32630" /note="Primer" ORIGIN 1 gctgcttata tgcagcatct //
LOCUS CS146133 22 bp DNA linear PAT 13-JUL-2006 DEFINITION Sequence 19 from Patent WO2005075679. ACCESSION CS146133 VERSION CS146133.1 GI:74036597 KEYWORDS . SOURCE synthetic construct ORGANISM synthetic construct other sequences; artificial sequences. REFERENCE 1 AUTHORS Amicosante,M., Cappelli,G., Colizzi,V., D'Arrigo,R., Dieli,F., Perno,C.F., Sacchi,A., Salerno,A., Montagner,L.U., Chenal,H., Toni,T. and Simpore,J. JOURNAL Patent: WO 2005075679-A 19 18-AUG-2005; ARRAY(0x141678e80) FEATURES Location/Qualifiers source 1..22 /organism="synthetic construct" /mol_type="unassigned DNA" /db_xref="taxon:32630" /note="Primer" ORIGIN 1 ctttttaaaa gaaaaggggg ga //
LOCUS CS146132 18 bp DNA linear PAT 13-JUL-2006 DEFINITION Sequence 18 from Patent WO2005075679. ACCESSION CS146132 VERSION CS146132.1 GI:74036596 KEYWORDS . SOURCE synthetic construct ORGANISM synthetic construct other sequences; artificial sequences. REFERENCE 1 AUTHORS Amicosante,M., Cappelli,G., Colizzi,V., D'Arrigo,R., Dieli,F., Perno,C.F., Sacchi,A., Salerno,A., Montagner,L.U., Chenal,H., Toni,T. and Simpore,J. JOURNAL Patent: WO 2005075679-A 18 18-AUG-2005; ARRAY(0x141678e80) FEATURES Location/Qualifiers source 1..18 /organism="synthetic construct" /mol_type="unassigned DNA" /db_xref="taxon:32630" /note="Primer" ORIGIN 1 ctgtgggtac acaggcat //
LOCUS CS146131 18 bp DNA linear PAT 13-JUL-2006 DEFINITION Sequence 17 from Patent WO2005075679. ACCESSION CS146131 VERSION CS146131.1 GI:74036595 KEYWORDS . SOURCE synthetic construct ORGANISM synthetic construct other sequences; artificial sequences. REFERENCE 1 AUTHORS Amicosante,M., Cappelli,G., Colizzi,V., D'Arrigo,R., Dieli,F., Perno,C.F., Sacchi,A., Salerno,A., Montagner,L.U., Chenal,H., Toni,T. and Simpore,J. JOURNAL Patent: WO 2005075679-A 17 18-AUG-2005; ARRAY(0x141678e80) FEATURES Location/Qualifiers source 1..18 /organism="synthetic construct" /mol_type="unassigned DNA" /db_xref="taxon:32630" /note="Primer" ORIGIN 1 gagccctgga accaccca //
LOCUS CS146130 22 bp DNA linear PAT 13-JUL-2006 DEFINITION Sequence 16 from Patent WO2005075679. ACCESSION CS146130 VERSION CS146130.1 GI:74036594 KEYWORDS . SOURCE synthetic construct ORGANISM synthetic construct other sequences; artificial sequences. REFERENCE 1 AUTHORS Amicosante,M., Cappelli,G., Colizzi,V., D'Arrigo,R., Dieli,F., Perno,C.F., Sacchi,A., Salerno,A., Montagner,L.U., Chenal,H., Toni,T. and Simpore,J. JOURNAL Patent: WO 2005075679-A 16 18-AUG-2005; ARRAY(0x141678e80) FEATURES Location/Qualifiers source 1..22 /organism="synthetic construct" /mol_type="unassigned DNA" /db_xref="taxon:32630" /note="Primer" ORIGIN 1 gcttcttcct gccataggag at //
LOCUS CS146129 18 bp DNA linear PAT 13-JUL-2006 DEFINITION Sequence 15 from Patent WO2005075679. ACCESSION CS146129 VERSION CS146129.1 GI:74036593 KEYWORDS . SOURCE synthetic construct ORGANISM synthetic construct other sequences; artificial sequences. REFERENCE 1 AUTHORS Amicosante,M., Cappelli,G., Colizzi,V., D'Arrigo,R., Dieli,F., Perno,C.F., Sacchi,A., Salerno,A., Montagner,L.U., Chenal,H., Toni,T. and Simpore,J. JOURNAL Patent: WO 2005075679-A 15 18-AUG-2005; ARRAY(0x141678e80) FEATURES Location/Qualifiers source 1..18 /organism="synthetic construct" /mol_type="unassigned DNA" /db_xref="taxon:32630" /note="Primer" ORIGIN 1 gatggaaaga gccccaga //
LOCUS CS146128 19 bp DNA linear PAT 13-JUL-2006 DEFINITION Sequence 14 from Patent WO2005075679. ACCESSION CS146128 VERSION CS146128.1 GI:74036592 KEYWORDS . SOURCE synthetic construct ORGANISM synthetic construct other sequences; artificial sequences. REFERENCE 1 AUTHORS Amicosante,M., Cappelli,G., Colizzi,V., D'Arrigo,R., Dieli,F., Perno,C.F., Sacchi,A., Salerno,A., Montagner,L.U., Chenal,H., Toni,T. and Simpore,J. JOURNAL Patent: WO 2005075679-A 14 18-AUG-2005; ARRAY(0x141678e80) FEATURES Location/Qualifiers source 1..19 /organism="synthetic construct" /mol_type="unassigned DNA" /db_xref="taxon:32630" /note="Primer" ORIGIN 1 cctgacatgc tgtcatcat //
LOCUS CS146127 20 bp DNA linear PAT 13-JUL-2006 DEFINITION Sequence 13 from Patent WO2005075679. ACCESSION CS146127 VERSION CS146127.1 GI:74036591 KEYWORDS . SOURCE synthetic construct ORGANISM synthetic construct other sequences; artificial sequences. REFERENCE 1 AUTHORS Amicosante,M., Cappelli,G., Colizzi,V., D'Arrigo,R., Dieli,F., Perno,C.F., Sacchi,A., Salerno,A., Montagner,L.U., Chenal,H., Toni,T. and Simpore,J. JOURNAL Patent: WO 2005075679-A 13 18-AUG-2005; ARRAY(0x141678e80) FEATURES Location/Qualifiers source 1..20 /organism="synthetic construct" /mol_type="unassigned DNA" /db_xref="taxon:32630" /note="Primer" ORIGIN 1 ccagaagtaa tacccatgtt //
LOCUS CS146126 20 bp DNA linear PAT 13-JUL-2006 DEFINITION Sequence 12 from Patent WO2005075679. ACCESSION CS146126 VERSION CS146126.1 GI:74036590 KEYWORDS . SOURCE synthetic construct ORGANISM synthetic construct other sequences; artificial sequences. REFERENCE 1 AUTHORS Amicosante,M., Cappelli,G., Colizzi,V., D'Arrigo,R., Dieli,F., Perno,C.F., Sacchi,A., Salerno,A., Montagner,L.U., Chenal,H., Toni,T. and Simpore,J. JOURNAL Patent: WO 2005075679-A 12 18-AUG-2005; ARRAY(0x141678e80) FEATURES Location/Qualifiers source 1..20 /organism="synthetic construct" /mol_type="unassigned DNA" /db_xref="taxon:32630" /note="Primer" ORIGIN 1 ggggtggctc cctctgataa //
LOCUS CS146125 18 bp DNA linear PAT 13-JUL-2006 DEFINITION Sequence 11 from Patent WO2005075679. ACCESSION CS146125 VERSION CS146125.1 GI:74036589 KEYWORDS . SOURCE synthetic construct ORGANISM synthetic construct other sequences; artificial sequences. REFERENCE 1 AUTHORS Amicosante,M., Cappelli,G., Colizzi,V., D'Arrigo,R., Dieli,F., Perno,C.F., Sacchi,A., Salerno,A., Montagner,L.U., Chenal,H., Toni,T. and Simpore,J. JOURNAL Patent: WO 2005075679-A 11 18-AUG-2005; ARRAY(0x141678e80) FEATURES Location/Qualifiers source 1..18 /organism="synthetic construct" /mol_type="unassigned DNA" /db_xref="taxon:32630" /note="Primer" ORIGIN 1 gactagcgga ggctagaa //
LOCUS CS146124 20 bp DNA linear PAT 13-JUL-2006 DEFINITION Sequence 10 from Patent WO2005075679. ACCESSION CS146124 VERSION CS146124.1 GI:74036588 KEYWORDS . SOURCE synthetic construct ORGANISM synthetic construct other sequences; artificial sequences. REFERENCE 1 AUTHORS Amicosante,M., Cappelli,G., Colizzi,V., D'Arrigo,R., Dieli,F., Perno,C.F., Sacchi,A., Salerno,A., Montagner,L.U., Chenal,H., Toni,T. and Simpore,J. JOURNAL Patent: WO 2005075679-A 10 18-AUG-2005; ARRAY(0x141678e80) FEATURES Location/Qualifiers source 1..20 /organism="synthetic construct" /mol_type="unassigned DNA" /db_xref="taxon:32630" /note="Primer" ORIGIN 1 gctgcttata tgcagcatct //
LOCUS CS146123 20 bp DNA linear PAT 13-JUL-2006 DEFINITION Sequence 9 from Patent WO2005075679. ACCESSION CS146123 VERSION CS146123.1 GI:74036587 KEYWORDS . SOURCE synthetic construct ORGANISM synthetic construct other sequences; artificial sequences. REFERENCE 1 AUTHORS Amicosante,M., Cappelli,G., Colizzi,V., D'Arrigo,R., Dieli,F., Perno,C.F., Sacchi,A., Salerno,A., Montagner,L.U., Chenal,H., Toni,T. and Simpore,J. JOURNAL Patent: WO 2005075679-A 9 18-AUG-2005; ARRAY(0x141678e80) FEATURES Location/Qualifiers source 1..20 /organism="synthetic construct" /mol_type="unassigned DNA" /db_xref="taxon:32630" /note="Primer" ORIGIN 1 ctcaaggcaa gctttattga //
LOCUS CS146122 22 bp DNA linear PAT 13-JUL-2006 DEFINITION Sequence 8 from Patent WO2005075679. ACCESSION CS146122 VERSION CS146122.1 GI:74036586 KEYWORDS . SOURCE synthetic construct ORGANISM synthetic construct other sequences; artificial sequences. REFERENCE 1 AUTHORS Amicosante,M., Cappelli,G., Colizzi,V., D'Arrigo,R., Dieli,F., Perno,C.F., Sacchi,A., Salerno,A., Montagner,L.U., Chenal,H., Toni,T. and Simpore,J. JOURNAL Patent: WO 2005075679-A 8 18-AUG-2005; ARRAY(0x141678e80) FEATURES Location/Qualifiers source 1..22 /organism="synthetic construct" /mol_type="unassigned DNA" /db_xref="taxon:32630" /note="Primer" ORIGIN 1 ctttttaaaa gaaaaggggg ga //
LOCUS CS146121 22 bp DNA linear PAT 13-JUL-2006 DEFINITION Sequence 7 from Patent WO2005075679. ACCESSION CS146121 VERSION CS146121.1 GI:74036585 KEYWORDS . SOURCE synthetic construct ORGANISM synthetic construct other sequences; artificial sequences. REFERENCE 1 AUTHORS Amicosante,M., Cappelli,G., Colizzi,V., D'Arrigo,R., Dieli,F., Perno,C.F., Sacchi,A., Salerno,A., Montagner,L.U., Chenal,H., Toni,T. and Simpore,J. JOURNAL Patent: WO 2005075679-A 7 18-AUG-2005; ARRAY(0x141678e80) FEATURES Location/Qualifiers source 1..22 /organism="synthetic construct" /mol_type="unassigned DNA" /db_xref="taxon:32630" /note="Primer" ORIGIN 1 gcttcttcct gccataggag at //
LOCUS CS146120 19 bp DNA linear PAT 13-JUL-2006 DEFINITION Sequence 6 from Patent WO2005075679. ACCESSION CS146120 VERSION CS146120.1 GI:74036584 KEYWORDS . SOURCE synthetic construct ORGANISM synthetic construct other sequences; artificial sequences. REFERENCE 1 AUTHORS Amicosante,M., Cappelli,G., Colizzi,V., D'Arrigo,R., Dieli,F., Perno,C.F., Sacchi,A., Salerno,A., Montagner,L.U., Chenal,H., Toni,T. and Simpore,J. JOURNAL Patent: WO 2005075679-A 6 18-AUG-2005; ARRAY(0x141678e80) FEATURES Location/Qualifiers source 1..19 /organism="synthetic construct" /mol_type="unassigned DNA" /db_xref="taxon:32630" /note="Primer" ORIGIN 1 gaaaggtgaa ggggcagta //
LOCUS CS146119 25 bp DNA linear PAT 13-JUL-2006 DEFINITION Sequence 5 from Patent WO2005075679. ACCESSION CS146119 VERSION CS146119.1 GI:74036583 KEYWORDS . SOURCE synthetic construct ORGANISM synthetic construct other sequences; artificial sequences. REFERENCE 1 AUTHORS Amicosante,M., Cappelli,G., Colizzi,V., D'Arrigo,R., Dieli,F., Perno,C.F., Sacchi,A., Salerno,A., Montagner,L.U., Chenal,H., Toni,T. and Simpore,J. JOURNAL Patent: WO 2005075679-A 5 18-AUG-2005; ARRAY(0x141678e80) FEATURES Location/Qualifiers source 1..25 /organism="synthetic construct" /mol_type="unassigned DNA" /db_xref="taxon:32630" /note="Primer" ORIGIN 1 ccatgttatt tttccacatg ttaaa //
LOCUS CS146118 24 bp DNA linear PAT 13-JUL-2006 DEFINITION Sequence 4 from Patent WO2005075679. ACCESSION CS146118 VERSION CS146118.1 GI:74036582 KEYWORDS . SOURCE synthetic construct ORGANISM synthetic construct other sequences; artificial sequences. REFERENCE 1 AUTHORS Amicosante,M., Cappelli,G., Colizzi,V., D'Arrigo,R., Dieli,F., Perno,C.F., Sacchi,A., Salerno,A., Montagner,L.U., Chenal,H., Toni,T. and Simpore,J. JOURNAL Patent: WO 2005075679-A 4 18-AUG-2005; ARRAY(0x141678e80) FEATURES Location/Qualifiers source 1..24 /organism="synthetic construct" /mol_type="unassigned DNA" /db_xref="taxon:32630" /note="Primer" ORIGIN 1 caattttaaa agaaaagggg ggat //
LOCUS CS146117 21 bp DNA linear PAT 13-JUL-2006 DEFINITION Sequence 3 from Patent WO2005075679. ACCESSION CS146117 VERSION CS146117.1 GI:74036581 KEYWORDS . SOURCE synthetic construct ORGANISM synthetic construct other sequences; artificial sequences. REFERENCE 1 AUTHORS Amicosante,M., Cappelli,G., Colizzi,V., D'Arrigo,R., Dieli,F., Perno,C.F., Sacchi,A., Salerno,A., Montagner,L.U., Chenal,H., Toni,T. and Simpore,J. JOURNAL Patent: WO 2005075679-A 3 18-AUG-2005; ARRAY(0x141678e80) FEATURES Location/Qualifiers source 1..21 /organism="synthetic construct" /mol_type="unassigned DNA" /db_xref="taxon:32630" /note="Primer" ORIGIN 1 ccctaaaaaa ttagcctgtc t //
LOCUS CS146116 21 bp DNA linear PAT 13-JUL-2006 DEFINITION Sequence 2 from Patent WO2005075679. ACCESSION CS146116 VERSION CS146116.1 GI:74036580 KEYWORDS . SOURCE synthetic construct ORGANISM synthetic construct other sequences; artificial sequences. REFERENCE 1 AUTHORS Amicosante,M., Cappelli,G., Colizzi,V., D'Arrigo,R., Dieli,F., Perno,C.F., Sacchi,A., Salerno,A., Montagner,L.U., Chenal,H., Toni,T. and Simpore,J. JOURNAL Patent: WO 2005075679-A 2 18-AUG-2005; ARRAY(0x141678e80) FEATURES Location/Qualifiers source 1..21 /organism="synthetic construct" /mol_type="unassigned DNA" /db_xref="taxon:32630" /note="Primer" ORIGIN 1 ccaattcccc ctatcatttt t //
LOCUS CS146115 20 bp DNA linear PAT 13-JUL-2006 DEFINITION Sequence 1 from Patent WO2005075679. ACCESSION CS146115 VERSION CS146115.1 GI:74036579 KEYWORDS . SOURCE synthetic construct ORGANISM synthetic construct other sequences; artificial sequences. REFERENCE 1 AUTHORS Amicosante,M., Cappelli,G., Colizzi,V., D'Arrigo,R., Dieli,F., Perno,C.F., Sacchi,A., Salerno,A., Montagner,L.U., Chenal,H., Toni,T. and Simpore,J. JOURNAL Patent: WO 2005075679-A 1 18-AUG-2005; ARRAY(0x141678e80) FEATURES Location/Qualifiers source 1..20 /organism="synthetic construct" /mol_type="unassigned DNA" /db_xref="taxon:32630" /note="Primer" ORIGIN 1 gcctcaataa agcttgcctt //
Apr 17 2007 11:10:07